PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G332700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 287aa    MW: 32782.5 Da    PI: 5.8017
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G332700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox566.9e-1882135356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Aqcoe3G332700.1.p  82 KKRRLNMEQVRTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 135
                        456899***********************************************9 PP

2HD-ZIP_I/II130.75.7e-4281171191
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                        ekkrrl+ eqv++LE++Fe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy++Lkr++da+k++n++L++++++L++e+
  Aqcoe3G332700.1.p  81 EKKRRLNMEQVRTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDQLKRQFDAIKADNDSLQAQNKKLHAEI 171
                        69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.38E-1972139IPR009057Homeodomain-like
PROSITE profilePS5007117.13577137IPR001356Homeobox domain
SMARTSM003891.4E-1780141IPR001356Homeobox domain
CDDcd000865.81E-1682138No hitNo description
PfamPF000462.9E-1582135IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-1884144IPR009057Homeodomain-like
PRINTSPR000311.1E-5108117IPR000047Helix-turn-helix motif
PROSITE patternPS000270112135IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5117133IPR000047Helix-turn-helix motif
PfamPF021837.1E-16137177IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MACNEMAFFP SNFMIQSSHE DHQDHHPPSS LNPIIPSCTP QDFHGVASFL GKRSMSFSGI  60
DMCEEANGED DLSDDGSQVG EKKRRLNMEQ VRTLEKNFEL GNKLEPERKM QLARALGLQP  120
RQIAIWFQNR RARWKTKQLE KDYDQLKRQF DAIKADNDSL QAQNKKLHAE ILALKNREPT  180
EFINLNKETE GSCSNRSDEN SSDINLDTSR TPAIDSPLSS HQSRPLFPSS LRPTSMVQLL  240
QNTSKSDMQC SKIEHHNVQE ESFCNMFSID DQPGFWPWPE QGSQFH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1129137RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010256832.11e-172PREDICTED: homeobox-leucine zipper protein ATHB-13-like
SwissprotQ8LC031e-112ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A0S2T0071e-162A0A0S2T007_VITVI; Homodomain-leucine zipper protein ATHB-13-like protein
STRINGVIT_01s0026g01950.t011e-161(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-113HD-ZIP family protein